XTP3TPA purified MaxPab mouse polyclonal antibody (B01P) View larger

XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079077-B01P
Product name: XTP3TPA purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human XTP3TPA protein.
Gene id: 79077
Gene name: DCTPP1
Gene alias: CDA03|MGC5627|RS21C6|XTP3TPA
Gene description: dCTP pyrophosphatase 1
Genbank accession: NM_024096
Immunogen: XTP3TPA (NP_077001.1, 1 a.a. ~ 170 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
Protein accession: NP_077001.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079077-B01P-13-15-1.jpg
Application image note: Western Blot analysis of DCTPP1 expression in transfected 293T cell line (H00079077-T01) by DCTPP1 MaxPab polyclonal antibody.

Lane 1: XTP3TPA transfected lysate(18.7 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy XTP3TPA purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart