Brand: | Abnova |
Reference: | H00079048-M08 |
Product name: | SECISBP2 monoclonal antibody (M08), clone 3A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SECISBP2. |
Clone: | 3A7 |
Isotype: | IgG2a Kappa |
Gene id: | 79048 |
Gene name: | SECISBP2 |
Gene alias: | DKFZp686C09169|SBP2 |
Gene description: | SECIS binding protein 2 |
Genbank accession: | NM_024077 |
Immunogen: | SECISBP2 (NP_076982.3, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMKALFKKKTYDEKKTYDQQKFDSERADGTISSEIKSARGSHHLSIYAENSLKSDGYHKRTDRKSRII |
Protein accession: | NP_076982.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SECISBP2 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |