Brand: | Abnova |
Reference: | H00079039-M01 |
Product name: | DDX54 monoclonal antibody (M01), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DDX54. |
Clone: | 2H6 |
Isotype: | IgG2a Kappa |
Gene id: | 79039 |
Gene name: | DDX54 |
Gene alias: | DP97|MGC2835 |
Gene description: | DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 |
Genbank accession: | NM_024072 |
Immunogen: | DDX54 (NP_076977, 778 a.a. ~ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM |
Protein accession: | NP_076977 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to DDX54 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |