Brand: | Abnova |
Reference: | H00079036-M07 |
Product name: | MGC2749 monoclonal antibody (M07), clone 4C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MGC2749. |
Clone: | 4C9 |
Isotype: | IgG2a Kappa |
Gene id: | 79036 |
Gene name: | C19orf50 |
Gene alias: | FLJ25480|MGC2749|MST096|MSTP096 |
Gene description: | chromosome 19 open reading frame 50 |
Genbank accession: | NM_024069 |
Immunogen: | MGC2749 (NP_076974, 81 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE |
Protein accession: | NP_076974 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |