Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00079026-M01 |
Product name: | AHNAK monoclonal antibody (M01), clone 3G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AHNAK. |
Clone: | 3G7 |
Isotype: | IgG2a Kappa |
Gene id: | 79026 |
Gene name: | AHNAK |
Gene alias: | AHNAKRS|MGC5395 |
Gene description: | AHNAK nucleoprotein |
Genbank accession: | NM_024060 |
Immunogen: | AHNAK (NP_076965, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTW |
Protein accession: | NP_076965 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of AHNAK expression in transfected 293T cell line by AHNAK monoclonal antibody (M01), clone 3G7. Lane 1: AHNAK transfected lysate(16 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | The C type natriuretic peptide receptor tethers AHNAK1 at the plasma membrane to potentiate arachidonic acid induced calcium mobilization.Alli AA, Gower WR Jr. Am J Physiol Cell Physiol. 2009 Aug 26. [Epub ahead of print] |