AHNAK purified MaxPab rabbit polyclonal antibody (D01P) View larger

AHNAK purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AHNAK purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about AHNAK purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00079026-D01P
Product name: AHNAK purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human AHNAK protein.
Gene id: 79026
Gene name: AHNAK
Gene alias: AHNAKRS|MGC5395
Gene description: AHNAK nucleoprotein
Genbank accession: NM_024060
Immunogen: AHNAK (NP_076965.2, 1 a.a. ~ 149 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLNTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL
Protein accession: NP_076965.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00079026-D01P-13-15-1.jpg
Application image note: Western Blot analysis of AHNAK expression in transfected 293T cell line (H00079026-T02) by AHNAK MaxPab polyclonal antibody.

Lane 1: AHNAK transfected lysate(16.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AHNAK purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart