DBNDD1 monoclonal antibody (M02), clone 4G4 View larger

DBNDD1 monoclonal antibody (M02), clone 4G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DBNDD1 monoclonal antibody (M02), clone 4G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DBNDD1 monoclonal antibody (M02), clone 4G4

Brand: Abnova
Reference: H00079007-M02
Product name: DBNDD1 monoclonal antibody (M02), clone 4G4
Product description: Mouse monoclonal antibody raised against a full-length recombinant DBNDD1.
Clone: 4G4
Isotype: IgG2b Kappa
Gene id: 79007
Gene name: DBNDD1
Gene alias: FLJ12582|MGC3101
Gene description: dysbindin (dystrobrevin binding protein 1) domain containing 1
Genbank accession: ENST00000304733
Immunogen: DBNDD1 (ENSP00000306407, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED
Protein accession: ENSP00000306407
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079007-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079007-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged DBNDD1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DBNDD1 monoclonal antibody (M02), clone 4G4 now

Add to cart