BOLL monoclonal antibody (M07), clone 1E1 View larger

BOLL monoclonal antibody (M07), clone 1E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BOLL monoclonal antibody (M07), clone 1E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about BOLL monoclonal antibody (M07), clone 1E1

Brand: Abnova
Reference: H00066037-M07
Product name: BOLL monoclonal antibody (M07), clone 1E1
Product description: Mouse monoclonal antibody raised against a partial recombinant BOLL.
Clone: 1E1
Isotype: IgG2a Kappa
Gene id: 66037
Gene name: BOLL
Gene alias: -
Gene description: bol, boule-like (Drosophila)
Genbank accession: NM_033030
Immunogen: BOLL (NP_149019, 185 a.a. ~ 283 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Protein accession: NP_149019
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00066037-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00066037-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged BOLL is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BOLL monoclonal antibody (M07), clone 1E1 now

Add to cart