FUNDC2 (Human) Recombinant Protein (Q04) View larger

FUNDC2 (Human) Recombinant Protein (Q04)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FUNDC2 (Human) Recombinant Protein (Q04)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about FUNDC2 (Human) Recombinant Protein (Q04)

Brand: Abnova
Reference: H00065991-Q04
Product name: FUNDC2 (Human) Recombinant Protein (Q04)
Product description: Human FUNDC2 partial ORF ( NP_076423.2, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 65991
Gene name: FUNDC2
Gene alias: DC44|FLJ33773|HCBP6|HCC3|MGC131676|MGC2495|PD03104
Gene description: FUN14 domain containing 2
Genbank accession: NM_023934.3
Immunogen sequence/protein sequence: METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFI
Protein accession: NP_076423.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00065991-Q04-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FUNDC2 (Human) Recombinant Protein (Q04) now

Add to cart