Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PYCRL monoclonal antibody (M01), clone 4F11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about PYCRL monoclonal antibody (M01), clone 4F11
| Brand: | Abnova |
| Reference: | H00065263-M01 |
| Product name: | PYCRL monoclonal antibody (M01), clone 4F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PYCRL. |
| Clone: | 4F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 65263 |
| Gene name: | PYCRL |
| Gene alias: | FLJ13852 |
| Gene description: | pyrroline-5-carboxylate reductase-like |
| Genbank accession: | NM_023078 |
| Immunogen: | PYCRL (NP_075566, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVV |
| Protein accession: | NP_075566 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PYCRL monoclonal antibody (M01), clone 4F11 Western Blot analysis of PYCRL expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Functional specialization in proline biosynthesis of melanoma.De Ingeniis J, Ratnikov B, Richardson AD, Scott DA, Aza-Blanc P, De SK, Kazanov M, Pellecchia M, Ronai Z, Osterman AL, Smith JW. PLoS One. 2012;7(9):e45190. Epub 2012 Sep 14. |