View larger

MRPS11 purified MaxPab mouse polyclonal antibody (B02P)

Reference:

Condition: New product

Data sheet of MRPS11 purified MaxPab mouse polyclonal antibody (B02P)

Brand:	Abnova
Reference:	H00064963-B02P
Product name:	MRPS11 purified MaxPab mouse polyclonal antibody (B02P)
Product description:	Mouse polyclonal antibody raised against a full-length human MRPS11 protein.
Gene id:	64963
Gene name:	MRPS11
Gene alias:	FLJ22512\|FLJ23406\|HCC-2
Gene description:	mitochondrial ribosomal protein S11
Genbank accession:	NM_022839.2
Immunogen:	MRPS11 (NP_073750.2, 1 a.a. ~ 194 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
Protein accession:	NP_073750.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of MRPS11 expression in transfected 293T cell line (H00064963-T02) by MRPS11 MaxPab polyclonal antibody. Lane 1: MRPS11 transfected lysate(21.34 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice