View larger

CENPH purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of CENPH purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00064946-D01P
Product name:	CENPH purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human CENPH protein.
Gene id:	64946
Gene name:	CENPH
Gene alias:	NNF1\|PMF1
Gene description:	centromere protein H
Genbank accession:	BC012024
Immunogen:	CENPH (AAH12024, 1 a.a. ~ 247 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
Protein accession:	AAH12024
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human,Mouse,Rat
Application image:
Application image note:	CENPH MaxPab rabbit polyclonal antibody. Western Blot analysis of CENPH expression in mouse kidney.
Applications:	WB-Ce,WB-Ti,WB-Tr
Shipping condition:	Dry Ice