No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB-Ce,WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00064946-D01P |
Product name: | CENPH purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CENPH protein. |
Gene id: | 64946 |
Gene name: | CENPH |
Gene alias: | NNF1|PMF1 |
Gene description: | centromere protein H |
Genbank accession: | BC012024 |
Immunogen: | CENPH (AAH12024, 1 a.a. ~ 247 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM |
Protein accession: | AAH12024 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | CENPH MaxPab rabbit polyclonal antibody. Western Blot analysis of CENPH expression in mouse kidney. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |