SLC30A5 monoclonal antibody (M03), clone 2E10 View larger

SLC30A5 monoclonal antibody (M03), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC30A5 monoclonal antibody (M03), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SLC30A5 monoclonal antibody (M03), clone 2E10

Brand: Abnova
Reference: H00064924-M03
Product name: SLC30A5 monoclonal antibody (M03), clone 2E10
Product description: Mouse monoclonal antibody raised against a full-length recombinant SLC30A5.
Clone: 2E10
Isotype: IgG2a Kappa
Gene id: 64924
Gene name: SLC30A5
Gene alias: FLJ12496|FLJ12756|MGC5499|ZNT5|ZNTL1|ZTL1|ZnT-5
Gene description: solute carrier family 30 (zinc transporter), member 5
Genbank accession: BC000808
Immunogen: SLC30A5 (AAH00808.1, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN
Protein accession: AAH00808.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064924-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.72 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064924-M03-13-15-1.jpg
Application image note: Western Blot analysis of SLC30A5 expression in transfected 293T cell line by SLC30A5 monoclonal antibody (M03), clone 2E10.

Lane 1: SLC30A5 transfected lysate (Predicted MW: 84 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SLC30A5 monoclonal antibody (M03), clone 2E10 now

Add to cart