Brand: | Abnova |
Reference: | H00064924-M01A |
Product name: | SLC30A5 monoclonal antibody (M01A), clone S3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SLC30A5. |
Clone: | S3 |
Isotype: | IgG2b Kappa |
Gene id: | 64924 |
Gene name: | SLC30A5 |
Gene alias: | FLJ12496|FLJ12756|MGC5499|ZNT5|ZNTL1|ZTL1|ZnT-5 |
Gene description: | solute carrier family 30 (zinc transporter), member 5 |
Genbank accession: | BC000808 |
Immunogen: | SLC30A5 (AAH00808.1, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN |
Protein accession: | AAH00808.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |