Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC30A5 monoclonal antibody (M01), clone 2F10-2B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SLC30A5 monoclonal antibody (M01), clone 2F10-2B8
| Brand: | Abnova |
| Reference: | H00064924-M01 |
| Product name: | SLC30A5 monoclonal antibody (M01), clone 2F10-2B8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SLC30A5. |
| Clone: | 2F10-2B8 |
| Isotype: | IgG2b kappa |
| Gene id: | 64924 |
| Gene name: | SLC30A5 |
| Gene alias: | FLJ12496|FLJ12756|MGC5499|ZNT5|ZNTL1|ZTL1|ZnT-5 |
| Gene description: | solute carrier family 30 (zinc transporter), member 5 |
| Genbank accession: | BC000808 |
| Immunogen: | SLC30A5 (AAH00808.1, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN |
| Protein accession: | AAH00808.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC30A5 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |