METTL4 purified MaxPab mouse polyclonal antibody (B01P) View larger

METTL4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of METTL4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about METTL4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064863-B01P
Product name: METTL4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human METTL4 protein.
Gene id: 64863
Gene name: METTL4
Gene alias: FLJ23017|HsT661|MGC117235
Gene description: methyltransferase like 4
Genbank accession: NM_022840.2
Immunogen: METTL4 (NP_073751.2, 1 a.a. ~ 472 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGS
Protein accession: NP_073751.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064863-B01P-13-15-1.jpg
Application image note: Western Blot analysis of METTL4 expression in transfected 293T cell line (H00064863-T01) by METTL4 MaxPab polyclonal antibody.

Lane1:METTL4 transfected lysate(51.92 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy METTL4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart