Brand: | Abnova |
Reference: | H00064844-M01 |
Product name: | MARCH7 monoclonal antibody (M01), clone 2B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MARCH7. |
Clone: | 2B9 |
Isotype: | IgG2b Kappa |
Gene id: | 64844 |
Gene name: | MARCH7 |
Gene alias: | AXO|AXOT|DKFZp586F1122|MARCH-VII|RNF177 |
Gene description: | membrane-associated ring finger (C3HC4) 7 |
Genbank accession: | NM_022826 |
Immunogen: | MARCH7 (NP_073737, 66 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG |
Protein accession: | NP_073737 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | MARCH7 monoclonal antibody (M01), clone 2B9 Western Blot analysis of MARCH7expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |