GNPNAT1 monoclonal antibody (M10), clone 1E9 View larger

GNPNAT1 monoclonal antibody (M10), clone 1E9

H00064841-M10_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNPNAT1 monoclonal antibody (M10), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about GNPNAT1 monoclonal antibody (M10), clone 1E9

Brand: Abnova
Reference: H00064841-M10
Product name: GNPNAT1 monoclonal antibody (M10), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant GNPNAT1.
Clone: 1E9
Isotype: IgG2a Kappa
Gene id: 64841
Gene name: GNPNAT1
Gene alias: FLJ10607|GNPNAT|Gpnat1
Gene description: glucosamine-phosphate N-acetyltransferase 1
Genbank accession: NM_198066
Immunogen: GNPNAT1 (NP_932332, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVE
Protein accession: NP_932332
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064841-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064841-M10-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to GNPNAT1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GNPNAT1 monoclonal antibody (M10), clone 1E9 now

Add to cart