Brand: | Abnova |
Reference: | H00064841-A01 |
Product name: | GNPNAT1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GNPNAT1. |
Gene id: | 64841 |
Gene name: | GNPNAT1 |
Gene alias: | FLJ10607|GNPNAT|Gpnat1 |
Gene description: | glucosamine-phosphate N-acetyltransferase 1 |
Genbank accession: | NM_198066 |
Immunogen: | GNPNAT1 (NP_932332, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVE |
Protein accession: | NP_932332 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | GNPNAT1 polyclonal antibody (A01), Lot # 051116JC01 Western Blot analysis of GNPNAT1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |