View larger

FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00064838-D01P
Product name:	FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human FNDC4 protein.
Gene id:	64838
Gene name:	FNDC4
Gene alias:	FLJ22362\|FRCP1
Gene description:	fibronectin type III domain containing 4
Genbank accession:	NM_022823.1
Immunogen:	FNDC4 (NP_073734.1, 1 a.a. ~ 234 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV
Protein accession:	NP_073734.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of FNDC4 expression in transfected 293T cell line (H00064838-T02) by FNDC4 MaxPab polyclonal antibody. Lane 1: FNDC4 transfected lysate(25.20 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice