Brand: | Abnova |
Reference: | H00064787-A01 |
Product name: | EPS8L2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant EPS8L2. |
Gene id: | 64787 |
Gene name: | EPS8L2 |
Gene alias: | EPS8R2|FLJ16738|FLJ21935|FLJ22171|MGC126530|MGC3088 |
Gene description: | EPS8-like 2 |
Genbank accession: | NM_022772 |
Immunogen: | EPS8L2 (NP_073609, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED |
Protein accession: | NP_073609 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | EPS8L2 polyclonal antibody (A01), Lot # 060614JCS1 Western Blot analysis of EPS8L2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |