Cart 28 Product Products 11 122,00 € (empty)
No products
To be determined Shipping
11 122,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 28 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 11 122,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 11 122,00 €
Data sheet of FLJ13912 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about FLJ13912 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00064785-B01P |
| Product name: | FLJ13912 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FLJ13912 protein. |
| Gene id: | 64785 |
| Gene name: | GINS3 |
| Gene alias: | FLJ13912|PSF3 |
| Gene description: | GINS complex subunit 3 (Psf3 homolog) |
| Genbank accession: | BC005879 |
| Immunogen: | FLJ13912 (AAH05879, 1 a.a. ~ 216 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYSEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED |
| Protein accession: | AAH05879 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GINS3 expression in transfected 293T cell line (H00064785-T01) by GINS3 MaxPab polyclonal antibody. Lane 1: FLJ13912 transfected lysate(23.87 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |