CERK purified MaxPab mouse polyclonal antibody (B01P) View larger

CERK purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CERK purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CERK purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064781-B01P
Product name: CERK purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CERK protein.
Gene id: 64781
Gene name: CERK
Gene alias: DKFZp434E0211|FLJ21430|FLJ23239|KIAA1646|LK4|MGC131878|dA59H18.2|dA59H18.3|hCERK
Gene description: ceramide kinase
Genbank accession: NM_182661
Immunogen: CERK (AAH04278.1, 1 a.a. ~ 201 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQRGPASGDPREGPPRQRREGCWGLHTCLITAARLRQSGWEHDLGVCSGSTDDKLWKLAVCKALASLLLLKCQIPMLYIDAKCLTQPGLGAVRRKLAIRGGGAGPGLPQDSSEAGPEVCTRGPDLSLSFLHTEFSIFIEHLVLLSQSSVNCVSDVCLLPRSHDGSLVSSAARGLRRPEDSSRKAFLPRSPGHPSIVYYVLV
Protein accession: AAH04278.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064781-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CERK expression in transfected 293T cell line (H00064781-T01) by CERK MaxPab polyclonal antibody.

Lane 1: CERK transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CERK purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart