Brand: | Abnova |
Reference: | H00064780-M06 |
Product name: | MICAL1 monoclonal antibody (M06), clone 3D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MICAL1. |
Clone: | 3D12 |
Isotype: | IgG2a Kappa |
Gene id: | 64780 |
Gene name: | MICAL1 |
Gene alias: | DKFZp434B1517|FLJ11937|FLJ21739|MICAL|MICAL-1|NICAL |
Gene description: | microtubule associated monoxygenase, calponin and LIM domain containing 1 |
Genbank accession: | NM_022765 |
Immunogen: | MICAL1 (NP_073602.2, 971 a.a. ~ 1067 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQG |
Protein accession: | NP_073602.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MICAL1 is 0.03 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |