CREB3L2 monoclonal antibody (M03), clone 1B8 View larger

CREB3L2 monoclonal antibody (M03), clone 1B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CREB3L2 monoclonal antibody (M03), clone 1B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CREB3L2 monoclonal antibody (M03), clone 1B8

Brand: Abnova
Reference: H00064764-M03
Product name: CREB3L2 monoclonal antibody (M03), clone 1B8
Product description: Mouse monoclonal antibody raised against a partial recombinant CREB3L2.
Clone: 1B8
Isotype: IgG2a Kappa
Gene id: 64764
Gene name: CREB3L2
Gene alias: BBF2H7|MGC131709|MGC71006
Gene description: cAMP responsive element binding protein 3-like 2
Genbank accession: NM_194071
Immunogen: CREB3L2 (NP_919047.2, 421 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNT
Protein accession: NP_919047.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064764-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064764-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CREB3L2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CREB3L2 monoclonal antibody (M03), clone 1B8 now

Add to cart