ACBD3 monoclonal antibody (M01), clone 5F12 View larger

ACBD3 monoclonal antibody (M01), clone 5F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACBD3 monoclonal antibody (M01), clone 5F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ACBD3 monoclonal antibody (M01), clone 5F12

Brand: Abnova
Reference: H00064746-M03
Product name: ACBD3 monoclonal antibody (M01), clone 5F12
Product description: Mouse monoclonal antibody raised against a partial recombinant ACBD3.
Clone: 5F12
Isotype: IgG2a Kappa
Gene id: 64746
Gene name: ACBD3
Gene alias: GCP60|GOCAP1|GOLPH1|PAP7
Gene description: acyl-Coenzyme A binding domain containing 3
Genbank accession: NM_022735
Immunogen: ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Protein accession: NP_073572
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064746-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064746-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged REV1L is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ACBD3 monoclonal antibody (M01), clone 5F12 now

Add to cart