Brand: | Abnova |
Reference: | H00064710-M02 |
Product name: | NUCKS1 monoclonal antibody (M02), clone 3G10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant NUCKS1. |
Clone: | 3G10 |
Isotype: | IgG2a Kappa |
Gene id: | 64710 |
Gene name: | NUCKS1 |
Gene alias: | FLJ21480|FLJ32016|FLJ38536|JC7|NUCKS |
Gene description: | nuclear casein kinase and cyclin-dependent kinase substrate 1 |
Genbank accession: | NM_022731.2 |
Immunogen: | NUCKS1 (NP_073568.2, 1 a.a. ~ 243 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED |
Protein accession: | NP_073568.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (53.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NUCKS1 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |