Brand: | Abnova |
Reference: | H00064582-M01 |
Product name: | GPR135 monoclonal antibody (M01), clone 1H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GPR135. |
Clone: | 1H5 |
Isotype: | IgG1 Kappa |
Gene id: | 64582 |
Gene name: | GPR135 |
Gene alias: | HUMNPIIY20 |
Gene description: | G protein-coupled receptor 135 |
Genbank accession: | NM_022571 |
Immunogen: | GPR135 (NP_072093, 391 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS |
Protein accession: | NP_072093 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to GPR135 on MCF-7 cell . [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |