FLJ12788 MaxPab mouse polyclonal antibody (B01) View larger

FLJ12788 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ12788 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FLJ12788 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00064427-B01
Product name: FLJ12788 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FLJ12788 protein.
Gene id: 64427
Gene name: TTC31
Gene alias: FLJ12788|FLJ33201|MGC120200
Gene description: tetratricopeptide repeat domain 31
Genbank accession: BC047084
Immunogen: FLJ12788 (AAH47084, 1 a.a. ~ 423 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDHQGLHRIHVDGSSGRLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSLLQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEPKASTTSDGDESPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPPREERPQQSPKVQASPGLLAAALQQSQELAKLGTSFAQNGFYHEAVVLFTQAFEAQPPGPPVGGGLARAGQSVEDSDLWPPSVFIRLFGNRSFCHERLGQPAWALADAQVALTLRPGWPRGLFRLGKALMGLQVIGLGLETGEI
Protein accession: AAH47084
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064427-B01-13-15-1.jpg
Application image note: Western Blot analysis of TTC31 expression in transfected 293T cell line (H00064427-T01) by TTC31 MaxPab polyclonal antibody.

Lane 1: FLJ12788 transfected lysate(46.53 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLJ12788 MaxPab mouse polyclonal antibody (B01) now

Add to cart