POLR1E purified MaxPab mouse polyclonal antibody (B01P) View larger

POLR1E purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POLR1E purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about POLR1E purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064425-B01P
Product name: POLR1E purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human POLR1E protein.
Gene id: 64425
Gene name: POLR1E
Gene alias: FLJ13390|FLJ13970|PAF53|PRAF1|RP11-405L18.3
Gene description: polymerase (RNA) I polypeptide E, 53kDa
Genbank accession: NM_022490.1
Immunogen: POLR1E (NP_071935.1, 1 a.a. ~ 419 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT
Protein accession: NP_071935.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064425-B01P-13-15-1.jpg
Application image note: Western Blot analysis of POLR1E expression in transfected 293T cell line (H00064425-T01) by POLR1E MaxPab polyclonal antibody.

Lane 1: PRAF1 transfected lysate(46.09 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POLR1E purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart