PRAF1 MaxPab mouse polyclonal antibody (B01) View larger

PRAF1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRAF1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about PRAF1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00064425-B01
Product name: PRAF1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PRAF1 protein.
Gene id: 64425
Gene name: POLR1E
Gene alias: FLJ13390|FLJ13970|PAF53|PRAF1|RP11-405L18.3
Gene description: polymerase (RNA) I polypeptide E, 53kDa
Genbank accession: NM_022490.1
Immunogen: PRAF1 (NP_071935.1, 1 a.a. ~ 419 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT
Protein accession: NP_071935.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064425-B01-13-15-1.jpg
Application image note: Western Blot analysis of POLR1E expression in transfected 293T cell line (H00064425-T01) by POLR1E MaxPab polyclonal antibody.

Lane 1: PRAF1 transfected lysate(46.09 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRAF1 MaxPab mouse polyclonal antibody (B01) now

Add to cart