Cart 6 Product Products 616,68 € (empty)
No products
To be determined Shipping
616,68 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 616,68 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 616,68 €
Data sheet of MLST8 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about MLST8 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00064223-D01P |
| Product name: | MLST8 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human MLST8 protein. |
| Gene id: | 64223 |
| Gene name: | MLST8 |
| Gene alias: | GBL|LST8|POP3|WAT1|GbetaL |
| Gene description: | MTOR associated protein, LST8 homolog (S. cerevisiae) |
| Genbank accession: | NM_022372 |
| Immunogen: | MLST8 (NP_071767.3, 1 a.a. ~ 326 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG |
| Protein accession: | NP_071767.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | MLST8 MaxPab rabbit polyclonal antibody. Western Blot analysis of MLST8 expression in mouse liver. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |