TFB2M monoclonal antibody (M01), clone 2E10 View larger

TFB2M monoclonal antibody (M01), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFB2M monoclonal antibody (M01), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about TFB2M monoclonal antibody (M01), clone 2E10

Brand: Abnova
Reference: H00064216-M01
Product name: TFB2M monoclonal antibody (M01), clone 2E10
Product description: Mouse monoclonal antibody raised against a partial recombinant TFB2M.
Clone: 2E10
Isotype: IgG1 Kappa
Gene id: 64216
Gene name: TFB2M
Gene alias: FLJ22661|FLJ23182|Hkp1
Gene description: transcription factor B2, mitochondrial
Genbank accession: NM_022366
Immunogen: TFB2M (NP_071761, 297 a.a. ~ 396 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR
Protein accession: NP_071761
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064216-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064216-M01-1-1-1.jpg
Application image note: TFB2M monoclonal antibody (M01), clone 2E10. Western Blot analysis of TFB2M expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TFB2M monoclonal antibody (M01), clone 2E10 now

Add to cart