TFB2M polyclonal antibody (A01) View larger

TFB2M polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TFB2M polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TFB2M polyclonal antibody (A01)

Brand: Abnova
Reference: H00064216-A01
Product name: TFB2M polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TFB2M.
Gene id: 64216
Gene name: TFB2M
Gene alias: FLJ22661|FLJ23182|Hkp1
Gene description: transcription factor B2, mitochondrial
Genbank accession: NM_022366
Immunogen: TFB2M (NP_071761, 297 a.a. ~ 396 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: YLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR
Protein accession: NP_071761
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064216-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064216-A01-1-23-1.jpg
Application image note: TFB2M polyclonal antibody (A01), Lot # 060608JCS1 Western Blot analysis of TFB2M expression in U-2 OS ( Cat # L022V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TFB2M polyclonal antibody (A01) now

Add to cart