LHX5 monoclonal antibody (M10), clone 2C6 View larger

LHX5 monoclonal antibody (M10), clone 2C6

H00064211-M10_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LHX5 monoclonal antibody (M10), clone 2C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about LHX5 monoclonal antibody (M10), clone 2C6

Brand: Abnova
Reference: H00064211-M10
Product name: LHX5 monoclonal antibody (M10), clone 2C6
Product description: Mouse monoclonal antibody raised against a full length recombinant LHX5.
Clone: 2C6
Isotype: IgG2a Kappa
Gene id: 64211
Gene name: LHX5
Gene alias: MGC129689
Gene description: LIM homeobox 5
Genbank accession: NM_022363
Immunogen: LHX5 (NP_071758, 114 a.a. ~ 182 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRG
Protein accession: NP_071758
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064211-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.59 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064211-M10-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged LHX5 is approximately 1ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LHX5 monoclonal antibody (M10), clone 2C6 now

Add to cart