Brand: | Abnova |
Reference: | H00064211-M06 |
Product name: | LHX5 monoclonal antibody (M06), clone 2B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LHX5. |
Clone: | 2B4 |
Isotype: | IgG2a Kappa |
Gene id: | 64211 |
Gene name: | LHX5 |
Gene alias: | MGC129689 |
Gene description: | LIM homeobox 5 |
Genbank accession: | NM_022363 |
Immunogen: | LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE |
Protein accession: | NP_071758 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |