Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LHX5 monoclonal antibody (M04), clone 2A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA |
More info about LHX5 monoclonal antibody (M04), clone 2A8
| Brand: | Abnova |
| Reference: | H00064211-M04 |
| Product name: | LHX5 monoclonal antibody (M04), clone 2A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LHX5. |
| Clone: | 2A8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 64211 |
| Gene name: | LHX5 |
| Gene alias: | MGC129689 |
| Gene description: | LIM homeobox 5 |
| Genbank accession: | NM_022363 |
| Immunogen: | LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE |
| Protein accession: | NP_071758 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to LHX5 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |