LHX5 monoclonal antibody (M01A), clone 1D9 View larger

LHX5 monoclonal antibody (M01A), clone 1D9

H00064211-M01A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LHX5 monoclonal antibody (M01A), clone 1D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LHX5 monoclonal antibody (M01A), clone 1D9

Brand: Abnova
Reference: H00064211-M01A
Product name: LHX5 monoclonal antibody (M01A), clone 1D9
Product description: Mouse monoclonal antibody raised against a partial recombinant LHX5.
Clone: 1D9
Isotype: IgG2a Kappa
Gene id: 64211
Gene name: LHX5
Gene alias: MGC129689
Gene description: LIM homeobox 5
Genbank accession: NM_022363
Immunogen: LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE
Protein accession: NP_071758
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064211-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LHX5 monoclonal antibody (M01A), clone 1D9 now

Add to cart