MMS19 purified MaxPab mouse polyclonal antibody (B01P) View larger

MMS19 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MMS19 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about MMS19 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064210-B01P
Product name: MMS19 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MMS19 protein.
Gene id: 64210
Gene name: MMS19
Gene alias: FLJ34167|FLJ95146|MET18|MGC99604|MMS19L|hMMS19
Gene description: MMS19 nucleotide excision repair homolog (S. cerevisiae)
Genbank accession: BC007298
Immunogen: MMS19 (AAH07298, 1 a.a. ~ 293 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS
Protein accession: AAH07298
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064210-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MMS19 expression in transfected 293T cell line (H00064210-T01) by MMS19 MaxPab polyclonal antibody.

Lane 1: MMS19L transfected lysate(32.34 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MMS19 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart