Brand: | Abnova |
Reference: | H00064151-M02 |
Product name: | NCAPG monoclonal antibody (M02), clone 2C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NCAPG. |
Clone: | 2C5 |
Isotype: | IgG1 Kappa |
Gene id: | 64151 |
Gene name: | NCAPG |
Gene alias: | CAPG|CHCG|FLJ12450|HCAP-G|MGC126525|NY-MEL-3 |
Gene description: | non-SMC condensin I complex, subunit G |
Genbank accession: | BC000827 |
Immunogen: | NCAPG (AAH00827, 336 a.a. ~ 435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS |
Protein accession: | AAH00827 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |