IFIH1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

IFIH1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFIH1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about IFIH1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00064135-D01P
Product name: IFIH1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human IFIH1 protein.
Gene id: 64135
Gene name: IFIH1
Gene alias: Hlcd|IDDM19|MDA-5|MDA5|MGC133047
Gene description: interferon induced with helicase C domain 1
Genbank accession: BC046208.1
Immunogen: IFIH1 (AAH46208.1, 1 a.a. ~ 221 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAGICNFTEEDSSNSA
Protein accession: AAH46208.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00064135-D01P-13-15-1.jpg
Application image note: Western Blot analysis of IFIH1 expression in transfected 293T cell line (H00064135-T02) by IFIH1 MaxPab polyclonal antibody.

Lane 1: IFIH1 transfected lysate(25.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IFIH1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart