SAMSN1 purified MaxPab mouse polyclonal antibody (B01P) View larger

SAMSN1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SAMSN1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SAMSN1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064092-B01P
Product name: SAMSN1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SAMSN1 protein.
Gene id: 64092
Gene name: SAMSN1
Gene alias: HACS1|NASH1|SASH2|SH3D6B
Gene description: SAM domain, SH3 domain and nuclear localization signals 1
Genbank accession: NM_022136.3
Immunogen: SAMSN1 (NP_071419.3, 1 a.a. ~ 373 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPSD
Protein accession: NP_071419.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064092-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SAMSN1 expression in transfected 293T cell line (H00064092-T01) by SAMSN1 MaxPab polyclonal antibody.

Lane 1: SAMSN1 transfected lysate(41.03 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SAMSN1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart