Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MCCC2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about MCCC2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00064087-A01 |
| Product name: | MCCC2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MCCC2. |
| Gene id: | 64087 |
| Gene name: | MCCC2 |
| Gene alias: | MCCB |
| Gene description: | methylcrotonoyl-Coenzyme A carboxylase 2 (beta) |
| Genbank accession: | NM_022132 |
| Immunogen: | MCCC2 (NP_071415, 456 a.a. ~ 563 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | AYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGIFRM |
| Protein accession: | NP_071415 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MCCC2 polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of MCCC2 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cryptic Exon Activation by Disruption of Exon Splice Enhancer: NOVEL MECHANISM CAUSING 3-METHYLCROTONYL-CoA CARBOXYLASE DEFICIENCY.Stucki M, Suormala T, Fowler B, Valle D, Baumgartner MR. J Biol Chem. 2009 Oct 16;284(42):28953-7. Epub 2009 Aug 24. |