NEUROD6 (Human) Recombinant Protein (P02) View larger

NEUROD6 (Human) Recombinant Protein (P02)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEUROD6 (Human) Recombinant Protein (P02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about NEUROD6 (Human) Recombinant Protein (P02)

Brand: Abnova
Reference: H00063974-P02
Product name: NEUROD6 (Human) Recombinant Protein (P02)
Product description: Human NEUROD6 full-length ORF ( NP_073565.2, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 63974
Gene name: NEUROD6
Gene alias: Atoh2|MATH2|Math-2|NEX1M|bHLHa2
Gene description: neurogenic differentiation 6
Genbank accession: NM_022728.2
Immunogen sequence/protein sequence: MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
Protein accession: NP_073565.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00063974-P02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NEUROD6 (Human) Recombinant Protein (P02) now

Add to cart