NEUROG2 monoclonal antibody (M12A), clone 1D2 View larger

NEUROG2 monoclonal antibody (M12A), clone 1D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEUROG2 monoclonal antibody (M12A), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about NEUROG2 monoclonal antibody (M12A), clone 1D2

Brand: Abnova
Reference: H00063973-M12A
Product name: NEUROG2 monoclonal antibody (M12A), clone 1D2
Product description: Mouse monoclonal antibody raised against a partial recombinant NEUROG2.
Clone: 1D2
Isotype: IgG2b Kappa
Gene id: 63973
Gene name: NEUROG2
Gene alias: Atoh4|MGC46562|Math4A|NGN2|bHLHa8|ngn-2
Gene description: neurogenin 2
Genbank accession: NM_024019
Immunogen: NEUROG2 (NP_076924, 74 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG
Protein accession: NP_076924
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy NEUROG2 monoclonal antibody (M12A), clone 1D2 now

Add to cart