Brand: | Abnova |
Reference: | H00063973-M08 |
Product name: | NEUROG2 monoclonal antibody (M08), clone 3D8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant NEUROG2. |
Clone: | 3D8 |
Isotype: | IgG2b Kappa |
Gene id: | 63973 |
Gene name: | NEUROG2 |
Gene alias: | Atoh4|MGC46562|Math4A|NGN2|bHLHa8|ngn-2 |
Gene description: | neurogenin 2 |
Genbank accession: | NM_024019 |
Immunogen: | NEUROG2 (NP_076924, 74 a.a. ~ 175 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG |
Protein accession: | NP_076924 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |