NEUROG2 monoclonal antibody (M08), clone 3D8 View larger

NEUROG2 monoclonal antibody (M08), clone 3D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEUROG2 monoclonal antibody (M08), clone 3D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NEUROG2 monoclonal antibody (M08), clone 3D8

Brand: Abnova
Reference: H00063973-M08
Product name: NEUROG2 monoclonal antibody (M08), clone 3D8
Product description: Mouse monoclonal antibody raised against a full length recombinant NEUROG2.
Clone: 3D8
Isotype: IgG2b Kappa
Gene id: 63973
Gene name: NEUROG2
Gene alias: Atoh4|MGC46562|Math4A|NGN2|bHLHa8|ngn-2
Gene description: neurogenin 2
Genbank accession: NM_024019
Immunogen: NEUROG2 (NP_076924, 74 a.a. ~ 175 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG
Protein accession: NP_076924
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00063973-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.22 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NEUROG2 monoclonal antibody (M08), clone 3D8 now

Add to cart