NEUROG2 monoclonal antibody (M07), clone 4B3 View larger

NEUROG2 monoclonal antibody (M07), clone 4B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEUROG2 monoclonal antibody (M07), clone 4B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about NEUROG2 monoclonal antibody (M07), clone 4B3

Brand: Abnova
Reference: H00063973-M07
Product name: NEUROG2 monoclonal antibody (M07), clone 4B3
Product description: Mouse monoclonal antibody raised against a full length recombinant NEUROG2.
Clone: 4B3
Isotype: IgG2a Kappa
Gene id: 63973
Gene name: NEUROG2
Gene alias: Atoh4|MGC46562|Math4A|NGN2|bHLHa8|ngn-2
Gene description: neurogenin 2
Genbank accession: NM_024019
Immunogen: NEUROG2 (NP_076924, 74 a.a. ~ 175 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG
Protein accession: NP_076924
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy NEUROG2 monoclonal antibody (M07), clone 4B3 now

Add to cart