Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 259,07 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 259,07 €
Data sheet of NEUROG2 purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about NEUROG2 purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00063973-B02P |
| Product name: | NEUROG2 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NEUROG2 protein. |
| Gene id: | 63973 |
| Gene name: | NEUROG2 |
| Gene alias: | Atoh4|MGC46562|Math4A|NGN2|bHLHa8|ngn-2 |
| Gene description: | neurogenin 2 |
| Genbank accession: | NM_024019.2 |
| Immunogen: | NEUROG2 (NP_076924.1, 1 a.a. ~ 272 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI |
| Protein accession: | NP_076924.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NEUROG2 expression in transfected 293T cell line (H00063973-T05) by NEUROG2 MaxPab polyclonal antibody. Lane 1: NEUROG2 transfected lysate(28.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |