DMRTB1 monoclonal antibody (M02), clone 5E7 View larger

DMRTB1 monoclonal antibody (M02), clone 5E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DMRTB1 monoclonal antibody (M02), clone 5E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about DMRTB1 monoclonal antibody (M02), clone 5E7

Brand: Abnova
Reference: H00063948-M02
Product name: DMRTB1 monoclonal antibody (M02), clone 5E7
Product description: Mouse monoclonal antibody raised against a full-length recombinant DMRTB1.
Clone: 5E7
Isotype: IgG2a Kappa
Gene id: 63948
Gene name: DMRTB1
Gene alias: -
Gene description: DMRT-like family B with proline-rich C-terminal, 1
Genbank accession: BC029566.1
Immunogen: DMRTB1 (AAH29566.1, 1 a.a. ~ 189 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD
Protein accession: AAH29566.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00063948-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063948-M02-13-15-1.jpg
Application image note: Western Blot analysis of DMRTB1 expression in transfected 293T cell line by DMRTB1 monoclonal antibody (M02), clone 5E7.

Lane 1: DMRTB1 transfected lysate(20.1 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DMRTB1 monoclonal antibody (M02), clone 5E7 now

Add to cart