Brand: | Abnova |
Reference: | H00063940-M01 |
Product name: | GPSM3 monoclonal antibody (M01), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GPSM3. |
Clone: | 1F11 |
Isotype: | IgG2a Kappa |
Gene id: | 63940 |
Gene name: | GPSM3 |
Gene alias: | C6orf9|G18|G18.1a|G18.1b|G18.2|NG1 |
Gene description: | G-protein signaling modulator 3 (AGS3-like, C. elegans) |
Genbank accession: | BC018724 |
Immunogen: | GPSM3 (AAH18724, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC |
Protein accession: | AAH18724 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GPSM3 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |