GPSM3 monoclonal antibody (M01), clone 1F11 View larger

GPSM3 monoclonal antibody (M01), clone 1F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPSM3 monoclonal antibody (M01), clone 1F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about GPSM3 monoclonal antibody (M01), clone 1F11

Brand: Abnova
Reference: H00063940-M01
Product name: GPSM3 monoclonal antibody (M01), clone 1F11
Product description: Mouse monoclonal antibody raised against a full-length recombinant GPSM3.
Clone: 1F11
Isotype: IgG2a Kappa
Gene id: 63940
Gene name: GPSM3
Gene alias: C6orf9|G18|G18.1a|G18.1b|G18.2|NG1
Gene description: G-protein signaling modulator 3 (AGS3-like, C. elegans)
Genbank accession: BC018724
Immunogen: GPSM3 (AAH18724, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC
Protein accession: AAH18724
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00063940-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063940-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GPSM3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GPSM3 monoclonal antibody (M01), clone 1F11 now

Add to cart